Glucagon-like-peptide 1

Glucagon-like-peptide 1
Glucagon-like-peptide 1

Masse/Länge Primärstruktur 37 Aminosäuren
Präkursor Preproglucagon
Isoformen 30/31 aa
Bezeichner
Gen-Name GCG
Externe IDs OMIM138030 UniProtP01275

Das Protein Glucagon-like Peptide 1 (GLP-1) ist ein Peptidhormon, das eine wichtige Rolle im Zuckerstoffwechsel im Rahmen des Inkretin-Effekts – der Insulinantwort der β-Zellen in der Bauchspeicheldrüse auf Glucosezufuhr über den Darm – spielt.

Erstmals wurde das GLP-1 im Jahre 1979 von der Arbeitsgruppe um Prof. Werner Creutzfeldt an der Universität Göttingen beschrieben.

Inhaltsverzeichnis

Bildung

GLP-1 wird als Darmhormon von den neuroendokrinen L-Zellen des Darms produziert und bei Nahrungsaufnahme in den Blutkreis freigesetzt. Es wird innerhalb von Minuten von dem Enzym Dipeptidylpeptidase 4 (DPP 4) abgebaut und muss also ständig neu produziert werden.

Beim Menschen besteht das wirksame Hormon aus den Aminosäuren 7-36 des Präglucagon-Proteins.[1]

Wirkungen

  • Es stimuliert die Produktion von Insulin in den Beta-Zellen der Bauchspeicheldrüse.
  • Es senkt die Produktion von Glucagon in den Alphazellen der Bauchspeicheldrüse. Glucagon selbst setzt Glucose (Traubenzucker) aus der Leber frei.
  • Es verzögert die Entleerung des Mageninhaltes in den Darm.
  • Es stimuliert das Sättigungsgefühl.

Durch die ersten beiden Wirkungen werden zu hohe Glukosewerte im Blut verhindert, durch die beiden anderen Wirkungen die Nahrungsaufnahme gedrosselt.[2]

GLP-1 und Insulinfreisetzung

GLP-1 wird unter dem Einfluss von Glukose aus den Darmzellen (Enterozyten) freigesetzt. GLP-1 aktiviert in den Inselzellen (ß-Zellen des Pankreas) Gs-gekoppelte Rezeptoren. Dadurch wird das Enzym Adenylatcyclase aktiviert. Dieses bildet cAMP aus ATP. cAMP aktiviert dann die Proteinkinase A. Dieses Enzym schließt dann Kalium-Kanäle. Kalium-Ionen strömen nicht mehr aus der Zelle aus. Das führt zu Depolarisation der Zellmembran. Dadurch werden spannungsabhängige Calcium-Kanäle geöffnet. Calcium-Ionen strömen ins Zellinnere und bewirken die Mobilisierung von Insulin-speichernden Vesikeln. Die Vesikel wandern zur Zellmembran und verschmelzen mit ihr, wodurch der Inhalt (Insulin) freigesetzt wird.

Diabetestherapie mit GLP-1

Bei der Analyse von Stoffen aus dem Speichel der Gila-Krustenechse wurde das Hormon Exendin-4 isoliert, das GLP-1 ähnelt und wie dieses an die Rezeptoren der Bauchspeicheldrüse bindet, aber von der Dipeptidylpeptidase 4 nicht abgebaut wird. Das US-amerikanische pharmazeutische Unternehmen Amylin stellt Exendin-4 unter dem Namen Exenatid gentechnisch her. Es ist als Arzneistoff zur subkutanen Injektion für Typ-II-Diabetiker entwickelt worden. Die Zulassung in den USA erfolgte 2005. 2006 hat die Europäische Arzneimittelagentur das Präparat unter dem Namen Byetta zugelassen. Der Vertrieb läuft gemeinsam mit Eli Lilly. Exenatide darf nur in Kombination mit einem oralen Antidiabetikum - Metformin oder Sulfonylharnstoff - verabreicht werden.[3][4]

Eine Alternative stellen die Inhibitoren der Dipeptidylpeptidase 4 dar, welche den Abbau des GLP-1 hemmen.

Quellen

  1. UniProt P01275
  2. [1] Klinische Pathophysiologie, Hrsg. Walter Siegenthaler, Google Books, abgerufen 18.März 2011
  3. Wang Z, Wang RM, Owji AA, Smith DM, Ghatei MA, Bloom SR: Glucagon-like peptide-1 is a physiological incretin in rat. In: J. Clin. Invest.. 95, Nr. 1, Januar 1995, S. 417–21. doi:10.1172/JCI117671. PMID 7814643. Volltext bei PMC: 295450.
  4. Kim W, Egan JM: The role of incretins in glucose homeostasis and diabetes treatment. In: Pharmacol. Rev.. 60, Nr. 4, Dezember 2008, S. 470–512. doi:10.1124/pr.108.000604. PMID 19074620. Volltext bei PMC: 2696340.

Wikimedia Foundation.

Игры ⚽ Поможем написать курсовую

Schlagen Sie auch in anderen Wörterbüchern nach:

  • Glucagon-like peptide-1 — (GLP 1) is derived from the transcription product of the proglucagon gene. The major source of GLP 1 in the body is the intestinal L cell that secretes GLP 1 as a gut hormone. The biologically active forms of GLP 1 are: GLP 1 (7 37) and GLP 1 (7… …   Wikipedia

  • Glucagon-like peptide-2 — (GLP 2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP 2 is created by specific post translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon like… …   Wikipedia

  • glucagon-Like Peptide — péptido derivado del proglucagón dotado de potentes propiedades insulinotrópicas Diccionario ilustrado de Términos Médicos.. Alvaro Galiano. 2010 …   Diccionario médico

  • Glucagon-like peptide 1 receptor — The glucagon like peptide 1 receptor (GLP1R) is a human gene which resides on chromosome 6.cite journal | author = Thorens B | title = Expression cloning of the pancreatic beta cell receptor for the gluco incretin hormone glucagon like peptide 1… …   Wikipedia

  • Glucagon-like peptide 2 receptor — The gene for the glucagon like peptide 2 receptor (GLP 2) is on chromosome 17.cite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon receptor family of G protein coupled receptors: the glucagon, GIP, GLP 1,… …   Wikipedia

  • glucagon-like peptide — (GLP) either of two intestinal peptide hormones (GLP 1 and GLP 2) secreted by the L cells in response to ingestion of nutrients, especially carbohydrates and fat rich meals. GLP 1 inhibits gastric emptying, food intake, and glucagon secretion and …   Medical dictionary

  • Glucagon — is an important hormone involved in carbohydrate metabolism. Produced by the pancreas, it is released when the glucose level in the blood is low (hypoglycemia), causing the liver to convert stored glycogen into glucose and release it into the… …   Wikipedia

  • Glucagon receptor family — The glucagon receptor familycite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon receptor family of G protein coupled receptors: the glucagon, GIP, GLP 1, and GLP 2 receptors | journal = Recept. Channels |… …   Wikipedia

  • Glucagon receptor — The glucagon receptor is a 62 kDa peptide that is activated by glucagon and is a member of the G protein coupled family of receptors, coupled to Gs.cite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon… …   Wikipedia

  • Glucagon hormone family — Pfam box Symbol = Hormone 2 Name = width = caption = Glucagon (PDB3|1gcn) Pfam= PF00123 InterPro= IPR000532 SMART= Prosite = PDOC00233 SCOP = 1gcn TCDB = OPM family= OPM protein= 1gcn PDB=PDB3|1geaA:132 151 PDB3|1d0rA:98 125 PDB3|1jrjA:48… …   Wikipedia

Share the article and excerpts

Direct link
Do a right-click on the link above
and select “Copy Link”