Denileukin Diftitox

Denileukin Diftitox
Denileukin Diftitox

Masse/Länge Primärstruktur 57,6473 kDa
Bezeichner
Externe IDs CAS-Nummer: 173146-27-5
Arzneistoffangaben
ATC-Code L01XX29
DrugBank DB00004
Wirkstoffklasse Immuntoxin
Verschreibungspflicht ja

Denileukin Diftitox, auch als DAB(389)IL-2 bezeichnet, ist der internationale Freiname für ein in den Vereinigten Staaten zugelassenes Immuntoxin zur Behandlung von Patienten mit therapierefraktären kutanem T-Zell-Lymphom.

Inhaltsverzeichnis

Beschreibung

Denileukin Diftitox ist ein rekombinant, das heißt gentechnisch, in Kulturen von Escherichia coli hergestelltes, zytotoxisches chimäres Fusionsprotein. Es besteht aus einer Interleukin-2-Peptid-Sequenz, die mit der des Diphtherietoxins fusioniert wurde. Das Interleukin-2 bindet dabei an den Interleukin-2-Rezeptor, der im Wesentlichen von T-Lymphozyten exprimiert wirdso auch von den malignen T-Lymphozyten.[1][2] Nach der Bindung an den Rezeptor wird das Immuntoxin von der Zelle per rezeptorvermittelter Endozytose internalisert. Im Endosom wird das Immuntoxin proteolytisch gespalten und dabei das katalytisch aktive A-Fragment des Toxins freigesetzt.[1] Die enzymatische Domäne des Toxins (das A-Fragment) katalysiert die Modifikation von Diphthamid, einer aus Histidin gebildeten Aminosäure, durch Übertragung eines ADP-Ribose-Restes aus NAD+ unter Abspaltung von Nicotinamid auf das Diphtamid (ADP-Ribosylierung). Der Elongationsfaktor-2 (EF-2), ein Enzym das die Translation bei der Proteinsynthese katalysiert, enthält Diphthamid. Durch die Modifikation des Diphthamids wird EF-2 in seiner Translationsfähigkeit gehemmt und die Proteinsynthese in der Zelle unterbrochen, was letztlich zum Tod der Zelle führt.[3]

Denileukin Diftitox wurde 1999 in den Vereinigten Staaten als erstes Immuntoxin von der FDA zugelassen. In Europa ist dagegen nicht zugelassen. Verschiedene klinische Studien für andere Indikationen, beispielsweise gegen Mycosis fungoides und malignes Melanom, sind derzeit am Laufen.

Denileukin Diftitox wird intravenös appliziert. Die Nebenwirkungen sind teilweise erheblich. Übelkeit, Erbrechen, Durchfall, Erschöpfungszustände, Atemschwierigkeiten, Fieber, Husten, Juckreiz und periphere Ödeme werden in über 20 Prozent der Patienten beobachtet. Bei über 10 Prozent ist das Vascular-Leak-Syndrom zu beobachten.[4] Es gibt Hinweise darauf, dass die Gabe von Denileukin Diftitox zu einem Verlust der Sehkraft führen kann.[5]

Denileukin Diftitox hat die folgende Proteinsequenz (im Einbuchstabencode):

MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNK
YDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVG
TEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMY
EYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVS
EEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEK
TTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYN
FVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYK
NPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVI
VLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT

Handelsname

Denileukin Diftitox wird in den USA unterm dem Markennamen Ontak vertrieben.

Literatur

  • J. W. Eklund und T. M. Kuzel: Denileukin diftitox: a concise clinical review. In: Expert Rev Anticancer Ther 5, 2005, S3338. PMID 15757436 (Review)
  • C. D. Carretero-Margolis und D. P. Fivenson: A complete and durable response to denileukin diftitox in a patient with mycosis fungoides. In: J Am Acad Dermatol 48, 2003, S275276. PMID 12582402
  • F. Foss: Clinical experience with denileukin diftitox (ONTAK). In: Semin Oncol 33, 2006, SS1116. PMID 16516670 (Review)
  • F. M. Foss: DAB(389)IL-2 (ONTAK): a novel fusion toxin therapy for lymphoma. In: Clin Lymphoma 1, 2000, S110116. PMID 11707818 (Review)
  • B. Y. Wong u. a.: Denileukin diftitox as novel targeted therapy for lymphoid malignancies. In: Cancer Invest 25, 2007, S495501. PMID 17882663
  • M. Duvic und R. Talpur: Optimizing denileukin diftitox (Ontak) therapy. In: Future Oncol 4, 2008, S457469. PMID 18684057 (Review)
  • D. P. Figgitt u. a.: Denileukin diftitox. In: Am J Clin Dermatol 1, 2000, S6772. PMID 11702307
  • M. T. Litzinger u. a.: IL-2 immunotoxin denileukin diftitox reduces regulatory T cells and enhances vaccine-mediated T-cell immunity. In: Blood 110, 2007, S31923201. PMID 17616639

Einzelnachweise

  1. a b F. Turturro: Denileukin diftitox: a biotherapeutic paradigm shift in the treatment of lymphoid-derived disorders. In: Expert Rev Anticancer Ther 7, 2007, S1117. PMID 17187516 doi:10.1586/14737140.7.1.11 (Review)
  2. C. Huber (Herausgeber) u. a.: Krebsimmuntherapien. Deutscher Ärzteverlag, 2007, ISBN 3-769-11212-1 S129
  3. National Cancer Institute: denileukin diftitox. eingesehen am 10. Juli 2009
  4. rxlist.com: ONTAK® (denileukin diftitox). eingesehen am 10. Juli 2009
  5. M. Park u. a.: Vision loss following denileukin diftitox treatment: a case report of possible posterior ischemic optic neuropathy. In: Leuk Lymphoma 48, 2007, S808811. PMID 17454642
Gesundheitshinweis Bitte den Hinweis zu Gesundheitsthemen beachten!

Wikimedia Foundation.

Игры ⚽ Нужно решить контрольную?

Schlagen Sie auch in anderen Wörterbüchern nach:

  • Denileukin diftitox — Systematic (IUPAC) name Diphtheria toxin Interleukin 2 fusion protein Clinical data AHFS/Drugs.com monograph …   Wikipedia

  • denileukin diftitox — den·i·leu·kin dif·ti·tox (den″ĭ looґkin difґtĭ toks) a fusion protein containing amino acid sequences for specific diphtheria toxin fragments linked to sequences for interleukin 2 (IL 2), so that the cytotoxic action of the… …   Medical dictionary

  • denileukin diftitox — A substance used to treat cutaneous T cell lymphoma when other treatments have not worked. It is also being studied in the treatment of chronic lymphocytic leukemia that has not responded to treatment. It belongs to the family of drugs called… …   English dictionary of cancer terms

  • Immuntoxin — Schematische Darstellung der Endozytose eines Immuntoxins in einer Krebszelle. Immuntoxine, auch als Immunotoxine bezeichnet, sind Immunkonjugate, die aus einer zellbindenden Komponente und einem Toxin bestehen. Immuntoxine sind potenzielle… …   Deutsch Wikipedia

  • Vascular-Leak-Syndrom — Bändermodell von Interleukin 2 Ödem als Folge eines durch …   Deutsch Wikipedia

  • Chemotherapy — A woman being treated with docetaxel chemotherapy for breast cancer. Cold mittens and wine coolers are placed on her hands and feet to reduce harm to her nails. Chemotherapy (sometimes cancer chemotherapy) is the treatment of cancer with an… …   Wikipedia

  • Ricin — (pronEng|ˈraɪ sɨn) is a protein toxin that is extracted from the castor bean ( Ricinus communis ).The U.S. Centers for Disease Control (CDC) gives a possible minimum figure of 500 micrograms (about the size of a grain of salt) Fact|date=May 2008… …   Wikipedia

  • ATC code L01 — A section of the Anatomical Therapeutic Chemical Classification System.L Antineoplastic and immunomodulating agentsL01A Alkylating agentsL01AA Nitrogen mustard analogues:L01AA01 Cyclophosphamide:L01AA02 Chlorambucil:L01AA03 Melphalan:L01AA05… …   Wikipedia

  • List of oncology-related terms — This is a list of terms related to oncology. The original source for this list was the U.S. National Cancer Institute s public domain Dictionary of Cancer Terms . NOTOC 1 * 10 propargyl 10 deazaaminopterin * 12 O tetradecanoylphorbol 13 acetate * …   Wikipedia

  • Cutaneous T cell lymphoma — DiseaseDisorder infobox Name = Cutaneous T cell lymphoma ICD10 = ICD10|C|84|0|c|81, ICD10|C|84|1|c|81 ICD9 = ICD9|202.1, ICD9|202.2 ICDO = ICDO|9700|3, ICDO|9701|3 Caption = OMIM = MedlinePlus = eMedicineSubj = med eMedicineTopic = 3486… …   Wikipedia

Share the article and excerpts

Direct link
https://de-academic.com/dic.nsf/dewiki/2315603 Do a right-click on the link above
and select “Copy Link”